Protein Info for mRNA_8412 in Rhodosporidium toruloides IFO0880

Name: 16780
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 68 to 87 (20 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 339 to 356 (18 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 473 to 496 (24 residues), see Phobius details PF07690: MFS_1" amino acids 106 to 444 (339 residues), 102.8 bits, see alignment E=9.6e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>mRNA_8412 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MVQTSIETLASTDSIPSEPAPPSPSFSYSTSPPPPSSSVESARHSYPPSRPDERQQTQLA
QPDRGKAAYLFLLGAFSIETLVWGLPSSYGVFLDYYQREGINGRHAGSSLLPLVGTVASG
FIYLLGPPISILLNPRPRRRLHVIRLGAVLCSLSLLLSSSARESWQLLLTQGLLYSIGGS
MAYYSTFYFLQEWFVERRGFANGVCFAGTAAGGLVLPFILNALLERYGAALTLRALAVST
FILLGAAVPLVRPRLPLPPKNFSQKLKKEDDLDEAELADQVAERPVVQRERMTLKKMAKN
LKLWVFLVANIGQAFGYFITLLYLPTYATSLGLSGSEGSALLACVNGACVLSRVAMGILS
DKHSPHRLGLATMLASSIAVLVLWGLASTSLVPLLVFSIVMGLASGGWTSMYSAIINSVV
RDDPSLASHLFSTLSFTRGLGAVLCAPISSALISHPFAGASKHTAYGAANGRFGGIVLFA
GLAMGMAAGCEGVEALLG