Protein Info for mRNA_8430 in Rhodosporidium toruloides IFO0880

Name: 16798
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 74 to 94 (21 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 277 to 302 (26 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 388 to 413 (26 residues), see Phobius details amino acids 424 to 447 (24 residues), see Phobius details amino acids 453 to 476 (24 residues), see Phobius details PF07690: MFS_1" amino acids 166 to 432 (267 residues), 52.7 bits, see alignment E=1.7e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>mRNA_8430 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MGLGILNDKHLENVPGTTLFSQDPNAVAESQYAGVDLSALKHGKGRNSHIVLVPQPSDDP
NDPLNWPRWKKHLTYGVLMYGTVLCGALGPLVAGAQVEMAQIFGVSLQAMSRALGTALVA
TLGIATLVWAPLATKYGKRPVYLLSTVFMLVGTIVASEAKTYGVLLVTPPISGQVFAHLG
WRWCWRIFYIATILLLVLQVFFLPETTYNRRRIAPASKPTDEKLSDLDKPELDQLESGSS
HMHKQKKSFVQEMSLYSGPFDKDRSFFQLAFEPVAALLSPAVLYAVCTYGLYITFLVVIA
TGSAQVYVGVYSFGAVGVGNTYLAPLVADFLAAALVGPLTDYLARRLSAANGGIFEPEFR
LPVMLAFLICSGAGFIGFGLSIRNHLSYWAPIIFAGVLNFGITIGCHGVIAYVVECHRHS
SDAALGAVIFGKNALSAIFTSFTNIWLAKGIDMAFIEMGVLCIGTSLFTIPMWIYGKRVR
SLIARKLHIERAAATVVDS