Protein Info for mRNA_8437 in Rhodosporidium toruloides IFO0880

Name: 16805
Annotation: K16948 CDC12 cell division control protein 12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 500 to 520 (21 residues), see Phobius details PF03193: RsgA_GTPase" amino acids 20 to 93 (74 residues), 33.2 bits, see alignment E=7.6e-12 PF00735: Septin" amino acids 21 to 295 (275 residues), 372 bits, see alignment E=2.9e-115 PF01926: MMR_HSR1" amino acids 26 to 158 (133 residues), 31.9 bits, see alignment E=1.9e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>mRNA_8437 K16948 CDC12 cell division control protein 12 (Rhodosporidium toruloides IFO0880)
MQGIGVSNLPNQRHKIVAKQGGHFTLMVVGESGLGKTTLINTLFSTELASVKDYSRRFAK
QMDKTTEIDIIKAELEEKQFKVKLTVIDTPGFGDYVNNRDSWIPIVDFVDDQHESYMRQE
QQPQRGSKLDLRVHACLYFIRPTGHSLKPLDIEIMKRLGSRVNLIPVVAKADTLTPQDLA
AFKQRIREVVQAQGIRIYTPPVDTDDEQAAEHARILSAAMPFSIIGSTDEVQTADGRSVK
GRQYLWGVAEVENEEHCDFKKLRSLLIRTHMLDLIQTTEEGHYESYRQTQMETRKFGEPK
VKKVENPKFKEEEEALRKRFTEQVKMEEARFRQWATPHRRARPPQQGPRADPQPNQGARA
RARPDWWRSDGLRLRCQPQHHWSPLDVSRSSSPSCLYPPPRPAASRSFDTSRSTHPFASR
PFLPLPSTLLSIAPPFARLCHSFSLPFVPARHAVASCNTRFRSEVGCLAASPHRWSPVAR
KSPERASRRLPDREEARTGVASRLVVVPLLVGVGAPLFAFTRYKG