Protein Info for mRNA_8438 in Rhodosporidium toruloides IFO0880

Name: 16806
Annotation: K07910 RAB18 Ras-related protein Rab-18

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00025: Arf" amino acids 18 to 179 (162 residues), 56.3 bits, see alignment E=6e-19 TIGR00231: small GTP-binding protein domain" amino acids 23 to 179 (157 residues), 89.9 bits, see alignment E=7.7e-30 PF08477: Roc" amino acids 25 to 147 (123 residues), 106.6 bits, see alignment E=2e-34 PF00071: Ras" amino acids 25 to 179 (155 residues), 163.8 bits, see alignment E=5.5e-52 PF01926: MMR_HSR1" amino acids 25 to 118 (94 residues), 28.1 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: K07910, Ras-related protein Rab-18 (inferred from 60% identity to uma:UM03602.1)

Predicted SEED Role

"Pro-zeta-carotene desaturase, prolycopene producing (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>mRNA_8438 K07910 RAB18 Ras-related protein Rab-18 (Rhodosporidium toruloides IFO0880)
MSYQTSSPTAQPSFGHMTEPPQTLKILVIGASSVGKSSLLLRFTDETFLSPDETSATIGV
DFKVKVIERKNKRWKLSIWDTAGQERFRTLTSSYYRGAQGVILVYDITARDTFESLSSWI
NELDTFAGTGPASREVVRMIVGNKVDKEFSRTVSTAEGQAFAASRDPPWMFMECSAKKGG
DDVSGDDGIFGKVVDKIIATPSLYTKIAPSTTSSSAKRQAGGGPPGQYPNRNGGTVNLDE
EMQGGSGWCSC