Protein Info for mRNA_4 in Rhodosporidium toruloides IFO0880

Name: 8372
Annotation: K00772 mtaP, MTAP 5'-methylthioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01694: methylthioadenosine phosphorylase
  • amino acids 17 to 271 (255 residues), 276.9 bits, E=6.1e-87
• PF01048: PNP_UDP_1
  • amino acids 17 to 272 (256 residues), 121.5 bits, E=1.8e-39

Best Hits

Swiss-Prot: 59% identical to MTAP1_PUCGT: S-methyl-5'-thioadenosine phosphorylase 1 (PGTG_06409) from Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL)

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

• S-methyl-5'-thioadenosine degradation II (1/1 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• L-methionine salvage cycle III (7/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28

Protein Sequence (354 amino acids)

>mRNA_4 K00772 mtaP, MTAP 5'-methylthioadenosine phosphorylase (Rhodosporidium toruloides IFO0880)
MPSVSPSHYTMDNAPLIGVIGGSGLYKLDNLEIVKTVNPVTPWGPPSSPITIASLSTPEG
PVTLAFLARHGPHHNIPPSNVPSRANIAALKRIGVKAIVAFSAVGSLREEIRPGDIIVPD
QIIDRTKGVRPSTYFDRTMVGHAMFGEPFDVQLREFIVPHVKEAINTFKGHINPSDEPRL
HTKKTVVVMEGPQFSTRAESNMYRLWGGDIINMSALPEAKLAREAELSYALVATSTDYDA
WRVDAAPVTVEEVMKTLRTNAELSKHITASILGAVHTAVKSGQIQGQTGQMQYSLMTPHK
EVGAEELHRLTYLLPNYFNYPDPAAERRSRSRARIDVDMDDYTGGEEHAPRGRQ