Protein Info for mRNA_31 in Rhodosporidium toruloides IFO0880

Name: 8399
Annotation: K01520 dut, DUT dUTP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00576: dUTP diphosphatase
  • amino acids 95 to 230 (136 residues), 184.1 bits, E=5.6e-59
• PF00692: dUTPase
  • amino acids 102 to 230 (129 residues), 155.7 bits, E=2.5e-50

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (7/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (2/3 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Protein Sequence (256 amino acids)

>mRNA_31 K01520 dut, DUT dUTP pyrophosphatase (Rhodosporidium toruloides IFO0880)
MTISDRPKQSTASSDPPSASLSEGELLALLLVDAACSLRVDDDTLCLLPFTELTRDCCMK
RTFPPPANTASTTAEPPAKRPAMSTTASSSPASFLVQRLSDSATVPTRGSSYAAGYDLYS
AEDKTVPAQGKALISTGLAIAVPEGTYGRVAPRSGLASKHMIDTGAGVIDADYRGEVKVL
LFNHAKEDFQISTGDRIAQLILERIVTPEPVEVSSLTETARGAGGFGSTGGFGVSEKVLE
AAKVLEAEKEVAASSN