Protein Info for mRNA_53 in Rhodosporidium toruloides IFO0880

Name: 8421
Annotation: K03014 RPB6, POLR2F DNA-directed RNA polymerases I, II, and III subunit RPABC2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01192: RNA_pol_Rpb6
  • amino acids 106 to 158 (53 residues), 55.5 bits, E=2.1e-19

Predicted SEED Role

"DNA-directed RNA polymerases I, II, and III 15 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase I or RNA polymerase II or RNA polymerase III (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (180 amino acids)

>mRNA_53 K03014 RPB6, POLR2F DNA-directed RNA polymerases I, II, and III subunit RPABC2 (Rhodosporidium toruloides IFO0880)
MPTRRGSGANGVLLHKQGCNRRLGRSFGGSGRTNQLLSFRFSLTHPRFPRTRSLTLPSLP
QNYENPEEAAEYLEQQHQLGGDEDQIVESGERPEGEMPAEANKERVTTPYMTKYERARIL
GTRALQISMNAPVLVPLDKETDPLEIAQKELAAKRIPLVVRRFLPDGSYEDWLVSELLTE