Protein Info for mRNA_94 in Rhodosporidium toruloides IFO0880

Name: 8462
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 119 to 141 (23 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details amino acids 461 to 485 (25 residues), see Phobius details amino acids 497 to 516 (20 residues), see Phobius details amino acids 529 to 553 (25 residues), see Phobius details PF07690: MFS_1" amino acids 140 to 513 (374 residues), 69.9 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: None (inferred from 60% identity to scm:SCHCODRAFT_258260)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>mRNA_94 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MAEKADTHSTSSLDAEKGVPLHQQQQQQKPAPTADHIEHYAQHTQGYSANLAAVQEAHGF
KPEAGRLVVDPAEARVEYGEEVASRLKTNRKGTKILWPQPSDDPNDPQNWSPVKKNIQLL
VLTMASFVPDFCSGLGIASLFNLAETFKTTTEEINNLTSNWSIFLLGPGGIAAVFFIKRF
GRLPVLFWSQVIGLGFLIGCAVSPDLKTFAAMRCLTAFFSTAPQCVGLWTVCDLFPFHLQ
ARKLNLWTMGFIVSPFISPFLLGYMIPTTNFRDVYWVGVAYCAVVVLLITFVMEETMYDR
DVVPFPERHATGLKYRIDTLIGITGWKMRKYRCTWWESISSVFDIVWRPHVFLMLVFVGF
LFGCGIGINVTQAVFIGSPPPLGYGYSPYATASLYATPIVAVILGELAGRYINDGLADRL
IKKNSGVFLAEMRLWTIYFAMPFYIVGFCLLGVAFQNKLSIAAVIFGWGMAEFGILILTV
ATYAYLNNCFPTRQGEVSALINLARTLGGFAIPYYQVPWSLTGGPKRVFGLEAGVGAALF
IVIVIPLQFFGPAIRRRFSVQK