Protein Info for mRNA_213 in Rhodosporidium toruloides IFO0880

Name: 8581
Annotation: KOG1362 Choline transporter-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details PF04515: Choline_transpo" amino acids 120 to 437 (318 residues), 235.7 bits, see alignment E=4.2e-74

Best Hits

Swiss-Prot: 48% identical to PNS1_USTMA: Protein PNS1 (PNS1) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: None (inferred from 40% identity to pan:PODANSg8480)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>mRNA_213 KOG1362 Choline transporter-like protein (Rhodosporidium toruloides IFO0880)
MEGKFDDVKPKFNDVIFALLFLAQLGAFIAISVISLRALPASEGSVGLGQSGGTATTLNA
STAWLLAIISGTALVLSILLLVLVRLFTKIILELCLLLAVAMSIGYAVYMWVERYWSGAI
IFTIFAVISILAYPGMRRRIPFSKALLLFVIRVAKFHPSVYVIALIGTTLTAAYSAYWAI
SVVAIYQKWSPNAEGASTSGGTPSSGAVIGLMVFAVFNLYYTTQFLTNLFLTTEAGIFGA
FYYGGRDAKKVAWGAFKRASTYSFGSIAFGSLLVALLDLLRAFFQILQSYESGQGDIIGA
AVACVAQCCVGCIAWAVEYLNRYAYIEISLYGKAYIPAAKDTWNLLRDRGITALINDCLV
GNIWTFGSYAVGGLSSLFAFVTVKASNPSYIQGNSGLVACITFYAFAIGFFICHSLGYAG
LSSGVSTVFVALAHDPEVLAERDPQLFETIRRTYPHVLNPV