Protein Info for mRNA_221 in Rhodosporidium toruloides IFO0880

Name: 8589
Annotation: HMMPfam-Squalene/phytoene synthase-PF00494,ProSitePatterns-Squalene and phytoene synthases signature 2.-PS01045,SUPERFAMILY--SSF48576,TIGRFAM-CarR_dom_SF lycopene cyclase domain-TIGR03462

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details TIGR03462: lycopene cyclase domain" amino acids 5 to 94 (90 residues), 69.6 bits, see alignment E=1.3e-23 amino acids 144 to 233 (90 residues), 58.4 bits, see alignment E=4e-20 PF00494: SQS_PSY" amino acids 292 to 601 (310 residues), 138.7 bits, see alignment E=1.4e-44

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (612 amino acids)

>mRNA_221 HMMPfam-Squalene/phytoene synthase-PF00494,ProSitePatterns-Squalene and phytoene synthases signature 2.-PS01045,SUPERFAMILY--SSF48576,TIGRFAM-CarR_dom_SF lycopene cyclase domain-TIGR03462 (Rhodosporidium toruloides IFO0880)
MGGLDYWLVHLRWTIPPALVLWSTFRKLRTRRDVYKTLFLITIAVTATIPWDSYLIRHRI
WSYPESSVVGPTLFAIPYEEIFFFFVQTYITATVYALFSRPVVHAVLLPRKPSDGRAARW
IGTAAFLGIFALAWAKLEEGGEGTYLALIVGWVAPFLALLWFIASTHILAMPRWAVGLPI
LLPTLYLWECDARALQRGTWVIEKGTKLGLAFRGLEIEEAVFFLLTNVMIVFGLVACDYC
LAVHDLRSYDKRTSSVFPPLRDFLPILLNSPDAAQRQRIEDLQAAIEILSIHSKSFSTAS
QVFEGRLRLDLLSLYAWCRVCDDLIDNASTVAAAESNIDMISGCLDLLYPPSSSTPTSLP
VRVSNKQIEAALPGLSEPERGAFRLLSLLPIARPPLNELLDGFRTDLSFLALSDSKGVKT
NGSANGNGNGISSISAELPIKTDSDLLVYANNVASSVADLCVQLVWAHCTPYSRTPAQSV
PRDPTLSEAENAHVLAAAREMGQALQLVNIARDVPADLKIGRIYLPGRGLDTPVPELTAD
RRALLARANEMAAQSKDAIEKLPQEARGGIRAACLVYLSIGDAVGRALDEGRVMERARVS
KGARARKAWQAL