Protein Info for mRNA_234 in Rhodosporidium toruloides IFO0880

Name: 8602
Annotation: K00452 HAAO 3-hydroxyanthranilate 3,4-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF06052: 3-HAO" amino acids 3 to 174 (172 residues), 176.3 bits, see alignment E=1.7e-56

Best Hits

Predicted SEED Role

"3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6)" in subsystem NAD and NADP cofactor biosynthesis global or Quinolinic acid and its derivatives (EC 1.13.11.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>mRNA_234 K00452 HAAO 3-hydroxyanthranilate 3,4-dioxygenase (Rhodosporidium toruloides IFO0880)
MLSPPLNIPKWLKENGHLLQPPVNNKCIYDGGDFTVMLVGGPNSRNDYHLNETGEWFYQL
KGAMTLKVIDNSKVGERVKTNEGLEAVAVTGGEFREITIDEGEMFLLPGNTPHNPCRYSD
TVGIVIERVRPGTAVDRLRWYCQNPEHASPTIIREVSFHCLDLGTQLKPLINEWMTKAEL
RVCPECGKEAEAK