Protein Info for mRNA_237 in Rhodosporidium toruloides IFO0880

Name: 8605
Annotation: K08098 PIGZ, SMP3 phosphatidylinositol glycan, class Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 68 to 87 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 128 to 159 (32 residues), see Phobius details amino acids 171 to 197 (27 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 254 to 265 (12 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF03901: Glyco_transf_22" amino acids 10 to 408 (399 residues), 198.9 bits, see alignment E=9.2e-63

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>mRNA_237 K08098 PIGZ, SMP3 phosphatidylinositol glycan, class Z (Rhodosporidium toruloides IFO0880)
MTLRRYARLYGVLALLRILIASTSTSAIHPDEHFQNPEIAASTVFEYALSSDGLLRTWEW
EGTAPCRSIVPVVGSTGWIFALLKLAVGDKPTGYALFLAQKLAMLLFSFLIDYLIWSTSN
GSPIPLLLFASSPVVFTFLLRPFSNSLETLVLAAAFYLAPRDAKRDSPFRLLAFGAVTAL
GIFTRITFVAFAAPLVLDVAQRLALQPSRSQSSLLRLAKRSIPIVLSFAITSLACAITDT
SYLSSTGSAPLSRLILTPLNLLRYNLSAANLAEHGLHPRYMHVLVNWPMLFGVGLAIIPT
AATTMRGAKDASSKPEERRRIILYLASFLLPTFLLSLQPHQEPRFLVPLIVPLALLAPYS
PLFRSGTKRARKWRRAFWALWLVHSTILIILFGYLHQGGLLPALFALNGQLSDPSIALGA
RRAVDIVFWRTFMPPRHLLLPARDGNSVAPAVRVTDLAGASFDTLVSTLLDKTQHHRSSA
AASHLTILVAPAYTVHSLDLLCSAHPTAAKPHNVCFEPVLVDKDGKERTFGVHVDMDRLE
ELRHTTWGTAGVGVWAVWRRASRDG