Protein Info for mRNA_239 in Rhodosporidium toruloides IFO0880

Name: 8607
Annotation: K01809 manA, MPI mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF01238: PMI_typeI" amino acids 6 to 371 (366 residues), 406.8 bits, see alignment E=5.1e-126 TIGR00218: mannose-6-phosphate isomerase, class I" amino acids 7 to 417 (411 residues), 284.7 bits, see alignment E=5.8e-89

Best Hits

Swiss-Prot: 53% identical to MPI_CRYNJ: Mannose-6-phosphate isomerase (MAN1) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 49% identity to scm:SCHCODRAFT_54767)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>mRNA_239 K01809 manA, MPI mannose-6-phosphate isomerase (Rhodosporidium toruloides IFO0880)
MSESPVFEIVCGAQSYDWGKLGKDGSKCSHFAKGLPNFEYDENKPYAELWMGTHPSCPST
LMATGQDLKKYLKSRPELLGNKVVKKFGDDLPFLFKVLAIRKALSIQAHPDKQLAQKLHS
EKPDIYKDPNHKPEMAVALTDFSGFCGFRPPSEIASFLDSVPEFAAVVGESVASSFKSKF
GSSSSPSEEDKKAGLKEIFTPLMKAEDKLVQEQVEKLVKRVEKGDSGLDKEESELIKTLN
SDFPGDVGIFCTFVLNIVRLKPGEAVFLKANEPHAYLDGDIMECMATSDNVVRAGLTPKL
RDVPTLTSMLTYTSSPPSEQIMNPVGFRSTKHTTLYDPPIDEFSVLLTDLKDGETEKFDA
VEGPSILIFTQLDGGAETARLRWSKGDEAIKREGQVFFVGAGEEISIEAKGGRVIAYRAF
VEA