Protein Info for mRNA_283 in Rhodosporidium toruloides IFO0880

Name: 8651
Annotation: K00872 thrB1 homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 14 to 333 (320 residues), 278.4 bits, E=2.7e-87
• PF00288: GHMP_kinases_N
  • amino acids 98 to 158 (61 residues), 40.5 bits, E=1.3e-14

Best Hits

Swiss-Prot: 52% identical to KHSE_YEAST: Homoserine kinase (THR1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 60% identity to cne:CNI02930)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (10/18 steps found)
• aspartate superpathway (15/25 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Protein Sequence (376 amino acids)

>mRNA_283 K00872 thrB1 homoserine kinase (Rhodosporidium toruloides IFO0880)
MFSAAPVAGQRKWTIRVPASSANIGPGFDVLGLALTRYLTLEVSLSPCPEAESKVVLSYT
GEGAKDAPTDPYKNLITRVALYVLLSHRLTFPAAVVNIVIDNQVPFGRGMGSSAAAVVAG
VLLGDALGDLKLPQERVKDYALMVERHPDNVTAALCGGFTGSFLRMLEPSELAPSSIPLA
EVLPAYPPNAGPPQPGDELPPQPPVNVGRHVRYGFSKEIGVVVVVPKFEVETAKARGALP
NSYPRQDVVFNLQRLAVLTASLSTSPLDPNVIWEAMRDKVHQPQREGLIPGLSKIVNTMT
PSTHPGLLGICLSGAGPTILALVSNEGATKPTEGKATPQMEAVGEAIKDIWAQDGIEVEW
LALDVDDEGAVLREHK