Protein Info for mRNA_303 in Rhodosporidium toruloides IFO0880

Name: 8671
Annotation: K00222 TM7SF2, ERG24 Delta14-sterol reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details PF01222: ERG4_ERG24" amino acids 18 to 463 (446 residues), 441 bits, see alignment E=4.6e-136 PF06966: DUF1295" amino acids 347 to 452 (106 residues), 32.4 bits, see alignment E=7e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>mRNA_303 K00222 TM7SF2, ERG24 Delta14-sterol reductase (Rhodosporidium toruloides IFO0880)
MAPSSDKGKVAAYDPAPRTEHYEFGGGLGALGVTLAVPFFTYWLAFACTADQCPPWPMSK
FVAFHSNGLEAMRASAWWESLWSWEAASVYLAWYFWTVACAIGLPGKEIEGVELRNGKKL
KYTMNGECLPSCRFPLADSPYCLFPAFSTMMVTLGCIAAWTYKFGPGALLYIPNHWPQLI
SAALAWSAFLATFVYYQSYIGTQMLALGGNTPNPFYNASLWFIGRGLNPRLGDFDIKAFN
EMRPGLILWIVIDLSMVAYQYSTIGRVTDSMILTVAFHSWYVLDAEFNEPAILTTMDITT
DGFGFMLSVGDLLWVPFTYSYTAYYLAFHPKDIGLSGCAGVLAVQLVGYWIFRSSNNEKN
EFRSGRNPKNLTSMQTERGTRLLTSGWWGMSRHPNYLGDWIMAWAWCLPCGFSTPLPYFY
PIYFGILLVHRQTRDDEACAKKYKKDWETYKRLVPWRIIPYVY