Protein Info for mRNA_308 in Rhodosporidium toruloides IFO0880

Name: 8676
Annotation: K07952 ARFRP1 ADP-ribosylation factor related protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00025: Arf" amino acids 11 to 184 (174 residues), 152.9 bits, see alignment E=1.9e-48 TIGR00231: small GTP-binding protein domain" amino acids 16 to 182 (167 residues), 70 bits, see alignment E=1e-23 PF09439: SRPRB" amino acids 17 to 152 (136 residues), 36 bits, see alignment E=1.5e-12 PF01926: MMR_HSR1" amino acids 20 to 134 (115 residues), 28.4 bits, see alignment E=4.6e-10 PF04670: Gtr1_RagA" amino acids 20 to 155 (136 residues), 37.5 bits, see alignment E=5.4e-13 PF08477: Roc" amino acids 20 to 136 (117 residues), 43.4 bits, see alignment E=1.1e-14 PF00071: Ras" amino acids 20 to 144 (125 residues), 40 bits, see alignment E=9.6e-14

Best Hits

KEGG orthology group: K07952, ADP-ribosylation factor related protein 1 (inferred from 47% identity to lth:KLTH0E11660g)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>mRNA_308 K07952 ARFRP1 ADP-ribosylation factor related protein 1 (Rhodosporidium toruloides IFO0880)
MYRLVTGFVAYLMQKQEYSVLIMGLDNAGKTTFLEKVKSTFNRTPDVDPKSIAPTIGQNI
GRITLSSTVLQFWDLGGQRDIRRIWPKYYAECHAVVFVIDSTDKERIEECWKVFEEIVTD
HRVDGVPTLVLANKQDCEGAMAVEDIKQMFNQLIVGKLNVSEGAVLPISALRGDGIREAV
DWLFLRVHHSRQVSHF