Protein Info for mRNA_324 in Rhodosporidium toruloides IFO0880

Name: 8692
Annotation: K00135 gabD succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 28 to 487 (460 residues), 550.7 bits, E=1.2e-169
• TIGR01780: succinate-semialdehyde dehydrogenase
  • amino acids 39 to 486 (448 residues), 674.8 bits, E=3e-207

Best Hits

Swiss-Prot: 54% identical to DAVD_PSEPK: Glutarate-semialdehyde dehydrogenase (davD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00135, succinate-semialdehyde dehydrogenase (NADP+) [EC: 1.2.1.16] (inferred from 59% identity to ssl:SS1G_02611)

MetaCyc: 52% identical to NAD(P)-dependent succinate-semialdehyde dehydrogenase (Pseudomonas fluorescens)
Succinate-semialdehyde dehydrogenase (NAD(P)(+)). [EC: 1.2.1.16]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• 4-aminobutanoate degradation III (2/2 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• ethylene glycol degradation (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• mitochondrial NADPH production (yeast) (2/5 steps found)
• octane oxidation (2/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• D-arabinose degradation I (1/4 steps found)
• putrescine degradation III (1/4 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• dopamine degradation (1/5 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• limonene degradation IV (anaerobic) (2/7 steps found)
• superpathway of glycol metabolism and degradation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• aromatic biogenic amine degradation (bacteria) (2/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (6/16 steps found)
• superpathway of pentose and pentitol degradation (6/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glutamate metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.16 or 1.2.1.3

Protein Sequence (493 amino acids)

>mRNA_324 K00135 gabD succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase (Rhodosporidium toruloides IFO0880)
MASNKAAPLKLKNPSLWIEKGGFVNGKWTAGANDGTFEVINPGNGQVLGTLPEMTVEDTK
EAVKVAHEALKSWRKTTETERAAILNKIFQIMTENSEDLAQIITAENGKPLADARGEVTY
GASYFTWFAGEAVRNYGDVIPSAVKGVQNMTLKQPIGVCAIITPWNFPNAMVTRKLAAAL
AAGNTVVMKAPAETPYSVLAIAEICRQAGVPDGVVNVVLTQKHTPDVGKELCENPLIHKL
SFTGSTRVGKILMKQASGTLKKLSFELGGNAPFIVFEDADLDKAVNGVIACKFRQSGQTC
VCANRILVHDAVFDKFSQKLADAVRKFKVGEGVKDGITHGPLIHEAAVNKVQQHVDDAVS
KGAKVVVGGKKLDVPGYFFEPTVLADVQSCAIDNEETFGPLAALYRFKTEEEAVEMANNT
EVGLAGYFFTENIARLYRVAAALEVGMVGANTGVISQAAIPFGGIKESGFGREGSKYGLQ
DWTNIKLIAVGGL