Protein Info for mRNA_339 in Rhodosporidium toruloides IFO0880

Name: 8707
Annotation: K01693 hisB imidazoleglycerol-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00475: IGPD
  • amino acids 44 to 187 (144 residues), 206.1 bits, E=1.5e-65

Best Hits

Swiss-Prot: 78% identical to HIS7_PHARH: Imidazoleglycerol-phosphate dehydratase (HIS3) from Phaffia rhodozyma

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 72% identity to mgl:MGL_3523)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Protein Sequence (208 amino acids)

>mRNA_339 K01693 hisB imidazoleglycerol-phosphate dehydratase (Rhodosporidium toruloides IFO0880)
MAAQYDPHSIRTATVTRKTGETDIQCTLTLDVEAGAKQVIEVDTGIGFLNHMLHALAKHG
KMSLQLKCKGDLEVDDHHTAEDCALALGEAFKKALGERRGIRRYGTGFAPLDEALARAVL
DISSRPYFCGDLQLKREKIGDLSCEMIPHVFHSFAEAAGVTLHVDVLRGFNDHHKSESAF
KALALAIREAIQRDNSGDVPSTKGVLAV