Protein Info for mRNA_341 in Rhodosporidium toruloides IFO0880

Name: 8709
Annotation: K00860 cysC adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 17 to 201 (185 residues), 255.1 bits, E=1.7e-80
• PF01583: APS_kinase
  • amino acids 33 to 189 (157 residues), 232.4 bits, E=2.4e-73
• PF13671: AAA_33
  • amino acids 37 to 151 (115 residues), 27.7 bits, E=2.8e-10

Best Hits

Swiss-Prot: 61% identical to KAPS_SACPS: Adenylyl-sulfate kinase (MET14) from Saccharomyces pastorianus

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 65% identity to yli:YALI0E00418g)

MetaCyc: 60% identical to Met14 (Saccharomyces cerevisiae)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Protein Sequence (208 amino acids)

>mRNA_341 K00860 cysC adenylylsulfate kinase (Rhodosporidium toruloides IFO0880)
MSAPHSTSEPVSKNIVWHEGVSQKQREELVGQRGVTIWFTGLSASGKSTLACALELELLQ
RGKRAFRLDGDNVRFGLNKDLGFSPKDREENIRRVGEVAKLVASSCTTTLTAFISPYLAD
RALARKIHEDSSIPFLEVFVDAPLEEVEKRDPKGLYAKARAGVIKEFTGISAPYEAPEKP
ELHIKTNETSIEEGVAHIVAYLEKNNFI