Protein Info for mRNA_347 in Rhodosporidium toruloides IFO0880

Name: 8715
Annotation: K01358 clpP, CLPP ATP-dependent Clp protease, protease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 50% identity to ptr:455637)

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>mRNA_347 K01358 clpP, CLPP ATP-dependent Clp protease, protease subunit (Rhodosporidium toruloides IFO0880)
MAALARAAPRGARLLAQTTPRTSQSLSLAYSLNTPHPPSLARQLSSTASRGTIIPYVISR
EPRGERVSDVYSRLLQERIVFLNGPVEDALSSVVVAQLLFLEAESSAPISLYINSPGGSV
TAGMAIYDTMQFVHCPVHTIVVGQASSMASLILAGGEPGHRSALAHSSIMIHQPSGGAGG
QASDISIQANEILRIREKMFDLYADHCKFRDEDRETARKRFAQVLDRDHYLTPEGAIGQG
IIDHVLKKRPSAMASTEGEGGIKGTNAP