Protein Info for mRNA_359 in Rhodosporidium toruloides IFO0880

Name: 8727
Annotation: BLAST minor histocompatibility antigen H13 [Kwoniella d...

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 57 to 78 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>mRNA_359 BLAST minor histocompatibility antigen H13 [Kwoniella d... (Rhodosporidium toruloides IFO0880)
MSSLMELGTYVAQQTAFLPALTGFSMAARGSLKTYLAAQALGPAPKVDDKDLKKLKWARC
LMVLVLCGGIFGLEFWLISQQDMKKLDIFFRYLNAFVYQSALTGTLLDMTKSLKWAAFRS
PGNVLHFRPAPGTVSFPRVLTAVALATGLNAATYFDLNWAFGSFLTVALLYRSLSSPFRR
VFSLRVMMLCMIAWLALTFLLSGLVILYVANYWMDGAAGDGTLDSSITGVSDTSSITSTE
VTRYMNLILPFAFSVFPGVLAVGCYRFDYANHVEANPELAAAVTLETCEPRKRFAKILSQ
GVVLPEKGPSGFLTPYFTTALWSWILAYVATFGLFAAAIPLPKDVLTNGAFDMTALTLAI
PFMIVGLVITASIRGEFRRIWKHKEVWSPKEDEAEGAIALPEDDVEAPLYAEVADEKHPE
IPDVVIEYAEPAPAYDAPSKQ