Protein Info for mRNA_372 in Rhodosporidium toruloides IFO0880

Name: 8740
Annotation: BLAST arsenical pump membrane protein [Exophiala dermat...

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 366 to 383 (18 residues), see Phobius details amino acids 442 to 461 (20 residues), see Phobius details amino acids 484 to 514 (31 residues), see Phobius details amino acids 535 to 561 (27 residues), see Phobius details amino acids 580 to 600 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>mRNA_372 BLAST arsenical pump membrane protein [Exophiala dermat... (Rhodosporidium toruloides IFO0880)
MTGLTAKSWVVLVVYAVVMGLVVKGIRIPLPRAVTRPLLKLAVQLRILDPPPPPHSPSSP
EDDPEIPSPNAISPKVSTTPSLNGSDATRTQAHQPVWEKRLSIPLDLRTSPIAGVIFLLI
TTCIDGHVVRLGIVGEEGIRPYDVLVLFISLAYISTALDSTGGLRALAFYISQKSARTPK
NSPPSAPKTASGLTLWTVLYLFWFFFGVLVGNDPIVLSGTAFLGYFTRSTGITAPRAWTM
SQFIAANVASAALVSSNPTNVLIAGAWELNFLTGFTAYTLLPTVLTALVAYPLLLSIFTI
FRPSNSPHSSSTTSSRQRYIPARLLPPDVDPRSALIDPSGAIFHASLLLITLCTLVGTSF
VKNVEVWMVTMPAGVIAFLRDVWSERRPPNVKRTEEIEMEAPTRPLDPPKSTLTPPTQHY
SLPYLLRKLTTRFPTTTTTISRLPFSLVLFAGGIFVLARSLTERGWTDIFAGWLSKICVD
SAATVFFVGYFTALVLCPICGTNIGGTILAVEIIRSPSFSQSARVLANPRILKSAIYSLA
LASNVGAMSWTLSSSLAGLLWASILAQKGIKVTQIEFARWMVPVLLVLSTVSSAVVLLEV
EYFRV