Protein Info for mRNA_398 in Rhodosporidium toruloides IFO0880

Name: 8766
Annotation: KOG1305 Amino acid transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details PF01490: Aa_trans" amino acids 37 to 445 (409 residues), 270.4 bits, see alignment E=1.2e-84

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>mRNA_398 KOG1305 Amino acid transporter protein (Rhodosporidium toruloides IFO0880)
MSPRNSPVPREDRTPLLHGASDDEAGPVKEHKRDGAATMTSCIANLANTIIGTGSLAMAH
AFAGEGLIPGIIMVLVCGGAAWLGLYLLTRSAAMAPHRAASFSSLSTLTYPGLARLFDFA
VALKCFGVSISYLIVIGGLMPKVVHSFRPDLVDSVLLDRRLWILASMTLLCPLAFLRRLD
SLKVTSYIALCAIGYLVFIVVYYSFSGHPELPPPGDVQLFRFGPSFIQVISIQTFAFTCA
QNIFAVFNELKSNTQARLNLVVGTSIGGAAIIYEVLGILGYLTFGSSVAGNIIEMYPRNK
LVSIGQVGITILVLFSYPLQLHPARASLDKFLFPHPTPADAEDDDTAIAPVDDHGSGDDI
PLTRFVVESAVLLFSTFFIAMFVSSLETVLGFVGATGSTTISFILPSVFFLALFKDSNTK
HDRRLRWVAMALLAWGVLVMVVSLSLNIYHLVQQPEQGSLHTLGWIGGKTAPHPLALAGD
SAALVDGVARR