Protein Info for mRNA_417 in Rhodosporidium toruloides IFO0880

Name: 8785
Annotation: KOG4697 Integral membrane protein involved in transport between the late Golgi and endosome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 38 to 65 (28 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details PF09801: SYS1" amino acids 30 to 96 (67 residues), 24.2 bits, see alignment E=1.6e-09 amino acids 141 to 232 (92 residues), 72.9 bits, see alignment E=1.6e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>mRNA_417 KOG4697 Integral membrane protein involved in transport between the late Golgi and endosome (Rhodosporidium toruloides IFO0880)
MPPAARLNFPASLRSPSMTVSTTSAPQRFRVQGWDPVLIVSQIVSLQALHYLVLSLVLPA
LLTIFSSSDLLQYEGGGASIALAMDWRAFTGSTVSGLAASRRLGAGLVSLDAARDAAVGW
TGAAAAAGKLDAAGLSHGVVRVLEYDALRGWAVALGWVIASMSDIFFLYHIVRRPTHILD
FSLTLIFVHLILTIYYSSSFPTSFFFWFVVGASSVAQIVLAEQLCVKREMRDGFSLGEVT
PHLGGVEMTPRFPDLELGQASGHSSKQSVSYARVPNEEDQV