Protein Info for mRNA_420 in Rhodosporidium toruloides IFO0880

Name: 8788
Annotation: K11209 yghU, yfcG GSH-dependent disulfide-bond oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13417: GST_N_3
  • amino acids 26 to 103 (78 residues), 34.6 bits, E=5.1e-12
• PF02798: GST_N
  • amino acids 46 to 99 (54 residues), 36.1 bits, E=1.7e-12
• PF13409: GST_N_2
  • amino acids 47 to 100 (54 residues), 29.8 bits, E=1.6e-10
• PF14497: GST_C_3
  • amino acids 150 to 231 (82 residues), 37 bits, E=8.2e-13
• PF00043: GST_C
  • amino acids 153 to 225 (73 residues), 46.9 bits, E=6.8e-16

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 48% identity to fgr:FG02000.1)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (268 amino acids)

>mRNA_420 K11209 yghU, yfcG GSH-dependent disulfide-bond oxidoreductase (Rhodosporidium toruloides IFO0880)
MTDSALSHGPKELQNKGLVLLLAQTPNGNKPVYLLEELKALGKIPDYTFVPVSFGKNEQK
SDWFEAVNPNGRIPALLDNREGKKPIKVWESASILLYLAKTYDTDATFHFKDEDLQTELL
NWIFFIQGGVGPMQGQANHFFRYAPEKIEYGIKRYQDETRRLYQIYEDHLNGTKDGEKKE
WLVGGKYTIADMCTQPWVRMAMWAGVELEKFPALAAWVERIEKRPATQAALKVPEQDMLS
KIKDDPEYADQLAKKSSDWIMKGNQAKK