Protein Info for mRNA_421 in Rhodosporidium toruloides IFO0880

Name: 8789
Annotation: K11209 yghU, yfcG GSH-dependent disulfide-bond oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF02798: GST_N" amino acids 31 to 105 (75 residues), 34 bits, see alignment E=9.3e-12 PF13417: GST_N_3" amino acids 31 to 109 (79 residues), 35 bits, see alignment E=4.8e-12 PF13409: GST_N_2" amino acids 41 to 105 (65 residues), 29.8 bits, see alignment E=1.8e-10 PF00043: GST_C" amino acids 151 to 224 (74 residues), 49.7 bits, see alignment E=1e-16 PF14497: GST_C_3" amino acids 154 to 230 (77 residues), 42.7 bits, see alignment E=1.7e-14 PF13410: GST_C_2" amino acids 155 to 219 (65 residues), 31.3 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 39% identity to ssl:SS1G_14440)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>mRNA_421 K11209 yghU, yfcG GSH-dependent disulfide-bond oxidoreductase (Rhodosporidium toruloides IFO0880)
MSDPSRPTQPRTEAPPGLDTPGLVLLYGSTPNGWKVTYALQALKEAGLIPDYTVVEVYLE
TGEQFQPWFRKVNPNSKMPVLIDNRAHKAPISVFESASILLYLSRTYDKRYLLHFEDDDL
EQRMLDWIFWVQGGLGPMQGQANHFARYSGERVEYAVERYTTETKRLYAVLDEHLEDKEY
IVGGKLSYADITAQPWVRCHFWCHIPLDPYPHLRAWHDRVENLPVIQRALKVPQQDLVTR
VKQDPELERRIMEAMQARKEKAEREKEESAA