Protein Info for mRNA_422 in Rhodosporidium toruloides IFO0880

Name: 8790
Annotation: KOG0911 Glutaredoxin-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00085: Thioredoxin" amino acids 20 to 109 (90 residues), 40 bits, see alignment E=6.9e-14 TIGR00365: monothiol glutaredoxin, Grx4 family" amino acids 167 to 261 (95 residues), 117.5 bits, see alignment E=1.2e-38 PF00462: Glutaredoxin" amino acids 177 to 241 (65 residues), 65.9 bits, see alignment E=6.2e-22 PF04908: SH3BGR" amino acids 193 to 260 (68 residues), 25.4 bits, see alignment E=2.6e-09

Best Hits

Predicted SEED Role

"Glutaredoxin-related protein" in subsystem Glutaredoxins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>mRNA_422 KOG0911 Glutaredoxin-related protein (Rhodosporidium toruloides IFO0880)
MASQSLPSNYHKVESPEDLQAKLSAALDKVSVLYFRTDWAEPCKTMDGVMLELAKRYEDV
LFLSVEAEALPDISESFEVDAVPYFILLRGHTLLTRLSGAQPSVLSAALKSHASKPSALS
ASSQQPLAAKTIYQPDEKASGAASASGTVAAGGQGDVEESDEELAARCDKLMKQSDVVLF
MKGDRETPRCGFSQKIVGILDSQKIDYSTFDILQDEGVRQKLKEINEWPTFPQLIIKGEF
VGGLDVVKEMEESGELQEMLQG