Protein Info for mRNA_445 in Rhodosporidium toruloides IFO0880

Name: 8813
Annotation: K03768 PPIB, ppiB peptidyl-prolyl cis-trans isomerase B (cyclophilin B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00160: Pro_isomerase" amino acids 34 to 188 (155 residues), 165.3 bits, see alignment E=7.1e-53

Best Hits

Swiss-Prot: 68% identical to PPIB_CRYNJ: Peptidyl-prolyl cis-trans isomerase B (CPR2) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K03768, peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC: 5.2.1.8] (inferred from 68% identity to cne:CNG01060)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>mRNA_445 K03768 PPIB, ppiB peptidyl-prolyl cis-trans isomerase B (cyclophilin B) (Rhodosporidium toruloides IFO0880)
MKFLSLALISTLLAVFANVALAAKGPVITNKVYFDVEHGGKPMGRIVMGLFGKTVPKTTE
NFRQLATGEAGFGYEGSHFHRVIKNFMIQGGDFTRGDGTGGKSIYGDRFADENFKLRHTG
PGLLSMANAGPDTNGSQFFITTVETSWLNNRHVVFGKVLEGMDIVYAIENVPKGHGDKPK
EQVKIVKSGELPVDKELDAEGKEIPLRAEL