Protein Info for mRNA_457 in Rhodosporidium toruloides IFO0880

Name: 8825
Annotation: K14963 WDR5, SWD3, CPS30 COMPASS component SWD3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00400: WD40" amino acids 14 to 41 (28 residues), 24 bits, see alignment (E = 1.4e-08) amino acids 56 to 89 (34 residues), 32.1 bits, see alignment 3.7e-11 amino acids 114 to 148 (35 residues), 38 bits, see alignment 5.4e-13 amino acids 153 to 190 (38 residues), 35.8 bits, see alignment 2.6e-12 amino acids 194 to 233 (40 residues), 24.2 bits, see alignment 1.2e-08 amino acids 240 to 277 (38 residues), 19 bits, see alignment 5.3e-07 PF12894: ANAPC4_WD40" amino acids 121 to 170 (50 residues), 22.8 bits, see alignment 2.3e-08 amino acids 127 to 201 (75 residues), 26.4 bits, see alignment E=1.8e-09 PF08662: eIF2A" amino acids 122 to 239 (118 residues), 31 bits, see alignment E=6e-11

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>mRNA_457 K14963 WDR5, SWD3, CPS30 COMPASS component SWD3 (Rhodosporidium toruloides IFO0880)
AANGPGRPDYSLRFTIEGHKKSISAVRFSPDGRWMASASADSPIHLHSLPSFSLHRTFSL
HTGGVSDVAFSADSTLLASASDDRSVRIWEITPHILQPSTGPDPDAEKGERSARVLQGHL
TAVFCVAWSPRGDLVASGGMDETVRVWDVQKGRMLRVLQAHSDPVSAVQFSRDGTMIVSC
SWDGYFRIWDTSTGQCLKTLVNEDNAPIASVRFTPNSKFLFTSTLDSTIRLWDYQADKVV
KAYTGHVNRKYCIPAIVTADGRYLLAGSEDHKVVMWNIQTREIVSSWIAHKDVVMAVAHH
PTQGILATGALEK