Protein Info for mRNA_467 in Rhodosporidium toruloides IFO0880

Name: 8835
Annotation: K07748 E1.1.1.170, NSDHL, ERG26 sterol-4alpha-carboxylate 3-dehydrogenase (decarboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 347 to 363 (17 residues), see Phobius details PF01073: 3Beta_HSD" amino acids 2 to 217 (216 residues), 183.3 bits, see alignment E=1.8e-57 PF13460: NAD_binding_10" amino acids 25 to 162 (138 residues), 36.5 bits, see alignment E=1.8e-12 PF16363: GDP_Man_Dehyd" amino acids 31 to 208 (178 residues), 44.7 bits, see alignment E=4.5e-15 PF01370: Epimerase" amino acids 32 to 211 (180 residues), 92.9 bits, see alignment E=8.1e-30 PF04321: RmlD_sub_bind" amino acids 35 to 182 (148 residues), 33.5 bits, see alignment E=9.3e-12 PF02719: Polysacc_synt_2" amino acids 40 to 105 (66 residues), 22 bits, see alignment E=2.9e-08 PF07993: NAD_binding_4" amino acids 72 to 202 (131 residues), 30.6 bits, see alignment E=6.8e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>mRNA_467 K07748 E1.1.1.170, NSDHL, ERG26 sterol-4alpha-carboxylate 3-dehydrogenase (decarboxylating) (Rhodosporidium toruloides IFO0880)
MVELLLERFPDATVSSLDLVQRHFPDKLAAGTSRKWSFYSADLTSLDSLSSAFRQAGATC
VFHTASPWTGSGADVCEKVNVQGTQTVVDACVKEGVKKLVFTSSAGTVYDGVDLINVDER
MPFPEKPIDPYNATKAKAEQIVLEANGKNGLLTVALRPAGIFGPGDRQAVPGMMDVLKTG
KTKFQVGENDNIFDWTYVDNVVHAHLIASQKLGQSVPLSVLEDRLVPIDLTVPRRQLPTS
DYRPPSLLEKEKELDPSFVNNEKGDEPLGATRNRFDPYFPEFIAHAFPNLDFSDEKALAD
GSLQIPIAGQAYFITNGEPVPFWDFPRALWAEYNGHVASWTLPLPAPLALGIAGIAETVM
GWLGKTPNMTRGKIVYSTVNRYYNIEKARRILGYEPIVGVQEGIKRAVAVRPPFSRVSQC
LADRFGVSQWYKENESSMQQKKA