Protein Info for mRNA_477 in Rhodosporidium toruloides IFO0880

Name: 8845
Annotation: K10256 FAD2 omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 76 to 94 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 158 to 168 (11 residues), see Phobius details amino acids 228 to 244 (17 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details PF00487: FA_desaturase" amino acids 119 to 399 (281 residues), 101 bits, see alignment E=5.2e-33

Best Hits

Predicted SEED Role

"Omega-6 fatty acid desaturase (EC 1.14.19.-) / Omega-6 oleate desaturase (EC 1.14.19.-)" (EC 1.14.19.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>mRNA_477 K10256 FAD2 omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase) (Rhodosporidium toruloides IFO0880)
MAATLRQRAAAQPTASKEKEHDVLASSDSEDEHNQDPLKALENEYPPFVVPNYSIKELLG
AIPAHCFERSALRSSLYVLGDFAMLAGLGYAASHIDPAFSFDGGKVLSGWAGFAAKWALW
SAYWVLAGWVGTGVWILGHECGHQAFSTSKTINNTMGLFLHSFVLVPYHSWRISHAKHHA
ATGHMTRDEVFVPRTASFRNPKPTGKKLRVSHNIELDELLEDAPLYRLGWLLVQQLFGWP
AYLFSNASGQLWYPKWTNHFDPSSLVFDARHRGQVLVSDAFLAGMVGLLVAFGQVVGLAG
VVKYYFIPYLFVNHWLVMITYLQHTDPSLPHYNAGMWNFQRGALCTMDRNMLGPVGPYLM
HGICETHVAHHLSSKIPHYHAWEATEALKNFLGEHYNYTDEGMFRSLWKAYRQCRYVDDE
GDVLFYRDAYGRARRVAVPAEVPSDSGVEGL