Protein Info for mRNA_487 in Rhodosporidium toruloides IFO0880

Name: 8855
Annotation: HMMPfam-Thioredoxin-PF00085,HMMPfam-PITH domain-PF06201,PRINTS-Thioredoxin family signature-PR00421,ProSitePatterns-Thioredoxin family active site.-PS00194,ProSiteProfiles-Thioredoxin domain profile.-PS51352,ProSiteProfiles-PITH domain profile.-PS51532,SUPERFAMILY--SSF49785,SUPERFAMILY--SSF52833

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 11 to 102 (92 residues), 88.1 bits, E=3.5e-29
• PF06201: PITH
  • amino acids 123 to 266 (144 residues), 140.2 bits, E=6.6e-45

Best Hits

Swiss-Prot: 40% identical to TXL1_SCHPO: Thioredoxin-like protein 1 (txl1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 42% identity to spu:581305)

Predicted SEED Role

No annotation

Protein Sequence (283 amino acids)

>mRNA_487 HMMPfam-Thioredoxin-PF00085,HMMPfam-PITH domain-PF06201,PRINTS-Thioredoxin family signature-PR00421,ProSitePatterns-Thioredoxin family active site.-PS00194,ProSiteProfiles-Thioredoxin domain profile.-PS51352,ProSiteProfiles-PITH domain profile.-PS51532,SUPERFAMILY--SSF49785,SUPERFAMILY--SSF52833 (Rhodosporidium toruloides IFO0880)
MSITVVSSLQQLDSLTSDANKVSIIDFHAVWCGPCKAIAPVFQRLASQYAGRVQFLKVDV
DAVPDVARKFSVSAMPTFVVLKGPNKVDEMKGANPAGLMAMVSKHAPASGGAGASGSGAP
TSLNSQIDLSQIHCLNEAAGHTIKDLLRGSGDKWLESDADEQLLLHIPIQQSIKLRAIRF
TTLSSHSANAPKTIKLFVNQSGVDFDNAESTEAAQEVVLDEAQAKGEKSVELRFVRFQNV
GHLSIFVVDNQGGEDVTRIDKLELIGVSVEGTNMADLKKMEEE