Protein Info for mRNA_508 in Rhodosporidium toruloides IFO0880

Name: 8876
Annotation: K16466 CETN3, CDC31 centrin-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF13833: EF-hand_8" amino acids 44 to 70 (27 residues), 16.2 bits, see alignment 2.3e-06 amino acids 135 to 183 (49 residues), 35.7 bits, see alignment E=2e-12 PF00036: EF-hand_1" amino acids 45 to 73 (29 residues), 30.6 bits, see alignment 4.7e-11 amino acids 158 to 184 (27 residues), 26.2 bits, see alignment 1.1e-09 PF13405: EF-hand_6" amino acids 45 to 74 (30 residues), 29.7 bits, see alignment 1.1e-10 amino acids 122 to 151 (30 residues), 26.9 bits, see alignment 8.5e-10 PF13499: EF-hand_7" amino acids 121 to 184 (64 residues), 54.6 bits, see alignment E=3.7e-18 PF13202: EF-hand_5" amino acids 159 to 183 (25 residues), 21.7 bits, see alignment (E = 3.3e-08)

Best Hits

Swiss-Prot: 54% identical to CETN3_MOUSE: Centrin-3 (Cetn3) from Mus musculus

KEGG orthology group: None (inferred from 58% identity to ppl:POSPLDRAFT_63783)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>mRNA_508 K16466 CETN3, CDC31 centrin-3 (Rhodosporidium toruloides IFO0880)
MSGMFGTPGVSKKPSPYSASRHHPSTTPSRQQPGPSQLSPDQQQEVREAFELFDLDKDQK
LDYHEFKVALRALGFDLKKAEVLKLMREHNHDEGGSGSLTIGLSGFMGIAEQLILARDPL
DEIRRAFKLFDTEGTGRISLRDLKKVARELGENLEEDELKAMIDEFDLDMDGAISEQEFI
KIMSDDV