Protein Info for mRNA_516 in Rhodosporidium toruloides IFO0880

Name: 8884
Annotation: K04482 RAD51 DNA repair protein RAD51

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR02239: DNA repair protein RAD51" amino acids 24 to 336 (313 residues), 543.7 bits, see alignment E=6.3e-168 PF14520: HHH_5" amino acids 33 to 74 (42 residues), 25.9 bits, see alignment 3.1e-09 PF08423: Rad51" amino acids 82 to 335 (254 residues), 406 bits, see alignment E=1.5e-125 PF00154: RecA" amino acids 93 to 304 (212 residues), 46 bits, see alignment E=1.2e-15 PF13481: AAA_25" amino acids 100 to 266 (167 residues), 40 bits, see alignment E=8.5e-14 PF06745: ATPase" amino acids 101 to 313 (213 residues), 30.1 bits, see alignment E=8e-11

Best Hits

Swiss-Prot: 73% identical to RAD51_USTMA: DNA repair protein RAD51 (RAD51) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K04482, DNA repair protein RAD51 (inferred from 73% identity to uma:UM03290.1)

Predicted SEED Role

"DNA repair protein RAD51" in subsystem DNA repair and recombination eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>mRNA_516 K04482 RAD51 DNA repair protein RAD51 (Rhodosporidium toruloides IFO0880)
MSQASQQSQGDDGYAGRVLPQPVTVLEGHCCTKKDIEKLVEAGYATLEAVAYTPKKLLCQ
VKGISEAKADKIIAHVSKMIPMGFTTATEFHARRADLVMITTGSTALDNILGGGIETGAI
TELYGEFRTGKSQICHQLAVTCQLPVDMKGGEGKCLYIDTEGTFRPERLLAISERYGMNG
EDVLDNVAYARAYNADHQSQLLVLAGAMMSESRFSLIIVDSVTSLYRTDYSGRGELSARQ
MHLAKFLRSLMRLADEFGVAVVVTNQVVASVDNAPGAPADARKPIGGNIMAHASTTRISM
RKGRGAERIARIVDSPCMPEADAKFQITAQGITDVNNGDGDGDDD