Protein Info for mRNA_518 in Rhodosporidium toruloides IFO0880

Name: 8886
Annotation: HMMPfam-Major Facilitator Superfamily-PF07690,SUPERFAMILY--SSF103473

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 276 to 291 (16 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 433 to 455 (23 residues), see Phobius details amino acids 475 to 497 (23 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 421 (409 residues), 68.5 bits, see alignment E=2.6e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>mRNA_518 HMMPfam-Major Facilitator Superfamily-PF07690,SUPERFAMILY--SSF103473 (Rhodosporidium toruloides IFO0880)
MSARVRVASGVAALANCLTAGAPFTFPLWAPTLERTLHLSSSQLNIVASAAILGEYASAA
GFGALADRRGPGAVSFAAAVLFGVGFGGLAWRYQRGAEWNGAGGQPWEYEWAALSLAWFI
CGCATAASYFGAITSLTKSAPSSHSGLAIGVPCAVFGLSPLFLSAIASFFTTHTATGETL
DVAKYLSFLGALLLAVNFIGGFLIKELPWEDNLDKVIVDAIEPFDDDEARVDEPDSGFAT
SPPRSVADEANERTSLLGKPAVNVDPTTSSQPFTAVLASPCFWLLGGVVFLSTGPAEMYM
ASIGQVLDTLVSNSVAAGATTQSALTLAKRHIALLSITNTAWRLVVGAASDYLAAPSDKQ
APVSAWRRHVRLVFVGAACALLVAAYGWGGTGLSTPSGLWIITLLTACSYGTVFTLTPTL
IRSRWAVVDFGRNWGAATLFSAAGALLFTPLFGILRDLASRKDGDGPRCVGPRCYRPIFA
LSAVSALLATALVAVLAQRWRKRL