Protein Info for mRNA_521 in Rhodosporidium toruloides IFO0880

Name: 8889
Annotation: K15102 SLC25A3, PHC, PIC solute carrier family 25 (mitochondrial phosphate transporter), member 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 257 to 274 (18 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details PF00153: Mito_carr" amino acids 88 to 173 (86 residues), 63.9 bits, see alignment E=5.4e-22 amino acids 190 to 271 (82 residues), 35.8 bits, see alignment E=3.1e-13 amino acids 290 to 368 (79 residues), 35.2 bits, see alignment E=4.8e-13

Best Hits

KEGG orthology group: K15102, solute carrier family 25 (mitochondrial phosphate transporter), member 3 (inferred from 61% identity to pno:SNOG_04532)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>mRNA_521 K15102 SLC25A3, PHC, PIC solute carrier family 25 (mitochondrial phosphate transporter), member 3 (Rhodosporidium toruloides IFO0880)
MVAQLMGSLFQGSFTTPALPAFSLGGVAASVVDDAKSKAEDLKNKASHAASSVGDKVDGA
RAAASTGAAQAVSKAAPGTIELYSGKYYATCALGGALACGTTHAFVTPLDLVKCRKQVDK
NIYKSNMDGWKKIHATEGGIRGLYTGVGPTLIGYSMQGAAKYGFYEYFKKFYSDLAGAEN
AVKYKDAIYLAGSASAEFFADMALVPMETVKVRMQTTFPPFATSAVSGLNKVVAAEGSGA
LFKSLPSLWGRQIPYTMMKFWSFEATVAAIYNALGAPKESYNKLQQLGVSATAGYIAGVF
CAVVSHPADTMVSKLNAPLAPGQAKPTVGSIYQEIGFGGLWGGLGTRIIMIGTLTALQWL
IYDTFKVTMGLPTTGSAAPDPTKK