Protein Info for mRNA_625 in Rhodosporidium toruloides IFO0880

Name: 8993
Annotation: K13162 PCBP2_3_4 poly(rC)-binding protein 2/3/4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF00013: KH_1" amino acids 107 to 165 (59 residues), 42.2 bits, see alignment E=5.8e-15 amino acids 186 to 248 (63 residues), 53.4 bits, see alignment E=1.9e-18 amino acids 297 to 365 (69 residues), 60.3 bits, see alignment E=1.3e-20 PF07650: KH_2" amino acids 187 to 220 (34 residues), 24.8 bits, see alignment 1.6e-09

Best Hits

KEGG orthology group: K13162, poly(rC)-binding protein 2/3/4 (inferred from 55% identity to lbc:LACBIDRAFT_176650)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>mRNA_625 K13162 PCBP2_3_4 poly(rC)-binding protein 2/3/4 (Rhodosporidium toruloides IFO0880)
MADSLTASNDLARKRSRSSSPSGDSAAKKANQAASAPAKLEIDDDGDNLLKDEYNGDDTK
PEHDSAPMNVDSSGIPAKPADPNPEQAPQDSSAAQSPAAQTITMRTLIVTQDASIIIGKQ
GKNINEIRDKSGAKLNITESVAGNPERIMSVTGALDAVSKAFGLIVRRINDEPFDVPSVP
GSRAVTIRFIIPNSRMGSVIGKAGSKIKEIQEASGARLQASEAMLPGSTERVLSVSGVAD
AIHIAVYYVGTVLLEHPVATSNQIYRPGGDYGRPPPSERYSAGPPPPRASGGNTQVQQLY
IPNELVGSIIGKGGARIGEVRAASGCQIKVNNADEPAPGSSPNERLVTITGDPSGISMAV
KMLYERLEREKARQTAGAL