Protein Info for mRNA_653 in Rhodosporidium toruloides IFO0880

Name: 9021
Annotation: HMMPfam-RTA1 like protein-PF04479

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details PF04479: RTA1" amino acids 80 to 304 (225 residues), 212.8 bits, see alignment E=2.2e-67

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>mRNA_653 HMMPfam-RTA1 like protein-PF04479 (Rhodosporidium toruloides IFO0880)
MPQLRSTFLRLVASAALVGSALASGDVNTAYTPDGELIIAGYLPSVPLSVVGLVFFGLST
LVLWTHFFRSTHARYMLVLTIGMLCMTLGFVFRILYHGNPATLGMYILQTMFILLSPCAF
LAMDYMLLGRLARALGDEATNCLFIRPTLISKLFITSDVITFLLQASGGGMSAGNSDGMR
KLGPKLALVGLILQLISFGIFTLLLLVWGLRVQKRLPRPIPRFRFSAFSMFSKQPVEDWR
PLFWVMCLTCVGIIVRSTFRIVEYSEGYYGYLATHEGYFYLLDALPLWLAMSLYCYFYPA
RFIDGAKSHSLTAVSSSSSEGTHTYAQRPYDVVEKGSPGAYRMNQFRS