Protein Info for mRNA_669 in Rhodosporidium toruloides IFO0880

Name: 9037
Annotation: K01689 ENO, eno enolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03952: Enolase_N
  • amino acids 30 to 160 (131 residues), 198.7 bits, E=5.8e-63
• TIGR01060: phosphopyruvate hydratase
  • amino acids 30 to 450 (421 residues), 567.9 bits, E=5.9e-175
• PF00113: Enolase_C
  • amino acids 171 to 459 (289 residues), 489.7 bits, E=4.5e-151
• PF13378: MR_MLE_C
  • amino acids 301 to 400 (100 residues), 40.5 bits, E=3.8e-14

Best Hits

Swiss-Prot: 73% identical to ENO_NEOFR: Enolase from Neocallimastix frontalis

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 78% identity to scm:SCHCODRAFT_72595)

MetaCyc: 68% identical to enolase (Saccharomyces cerevisiae)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• Bifidobacterium shunt (14/15 steps found)
• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• gluconeogenesis I (11/13 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• gallate biosynthesis (2/3 steps found)
• quinate degradation I (2/3 steps found)
• quinate degradation II (2/3 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• superpathway of chorismate metabolism (28/59 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (5/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.11

Use Curated BLAST to search for 4.2.1.11

Protein Sequence (473 amino acids)

>mRNA_669 K01689 ENO, eno enolase (Rhodosporidium toruloides IFO0880)
MRRRTTTSELISRSPSSPSLFPLRNNTMPIQKIHARQIWDSRGNPTVEVDVTTEKGLFRA
AVPSGASTGVHEAVELRDGDKSKYLGKGVHKAVANVNDVIAPKLIEANLDITNQEAVDDF
LIKLDGTPNKGKLGANAILGVSMAVAKAAAAQKGVPLYVHFAELAGVKAPYILPVPAMNV
INGGSHAGNALAFQEFMLLPTGAADFDEAMQMGTETYHTLKNVIKKKYGIDATNVGDEGG
FAPNVQGAEESLDLLTEAIEKAGYTGKVQIGLDVASSEFYKDGKYDLDFKNPNSDSSKWL
TGQQLAEVYNNLVEKYDIVSIEDPFDQDDWEAWTHLTQNTKIQIVGDDLTVTNPKRIQTA
IEKKACNGLLLKVNQIGSITESIKATQLASSDGWGTMCSHRSGETEDTTIADLVVGLGTG
QIKTGAPCRSERVAKYNQLIRIADEIKQAGGQVRYAGADGLSRGPNAAPLSRK