Protein Info for mRNA_674 in Rhodosporidium toruloides IFO0880

Name: 9042
Annotation: K04382 PPP2C serine/threonine-protein phosphatase 2A catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00149: Metallophos" amino acids 48 to 239 (192 residues), 126.9 bits, see alignment E=7.7e-41

Best Hits

Swiss-Prot: 88% identical to PP2A1_NEUCR: Serine/threonine-protein phosphatase PP2A catalytic subunit (pph-1) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K04382, protein phosphatase 2 (formerly 2A), catalytic subunit [EC: 3.1.3.16] (inferred from 96% identity to uma:UM03957.1)

MetaCyc: 87% identical to serine/threonine-protein phosphatase 2A catalytic subunit (Homo sapiens)
Phosphoprotein phosphatase. [EC: 3.1.3.16]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>mRNA_674 K04382 PPP2C serine/threonine-protein phosphatase 2A catalytic subunit (Rhodosporidium toruloides IFO0880)
MADISETDAWISHLTDCKQLTEMDVKRLCDKAREILIEESNVQPVRCPVTVCGDIHGQFH
DLSELFRIGGNSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRVTILRGNHESRQI
TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIDDQIFCLHGGLSPSIDTLDHIRSI
DRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEAFNHNNGLTLVARAHQL
VMEGYNWSHDRNVVTIFSAPNYCYRCGNQAAIMEIDENMKYTFLQFDPAPRAGEPLVSRR
VPDYFL