Protein Info for mRNA_711 in Rhodosporidium toruloides IFO0880

Name: 9079
Annotation: K00972 UAP1 UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 48% identical to UAP1_MOUSE: UDP-N-acetylhexosamine pyrophosphorylase (Uap1) from Mus musculus

KEGG orthology group: K00972, UDP-N-acetylglucosamine pyrophosphorylase [EC: 2.7.7.23] (inferred from 63% identity to cci:CC1G_06565)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase eukaryotic (EC 2.7.7.23)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.7.7.23)

MetaCyc Pathways

UDP-N-acetyl-D-glucosamine biosynthesis II (5/6 steps found)
chitin biosynthesis (7/9 steps found)
UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
UDP-N-acetyl-D-glucosamine biosynthesis I (3/5 steps found)
O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
anhydromuropeptides recycling I (2/12 steps found)
superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)
superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (4/25 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>mRNA_711 K00972 UAP1 UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase (Rhodosporidium toruloides IFO0880)
MSAPFAADVQALRSSYEKAGQGHVFTFWDKLTAEEQSTFYRQLLSLNPERINSIHASSLE
AEKAAAASTHDEITPPPADQSGSVIGNEKQAAEWNEVGLKAVREGKVAVLLMAGGQGTRL
GSSAPKGCYDIGLPSHKSLFQLQAERIKRLQTVAGADKPVPWYVMTSGPTRKPTEEFFAA
NGFFGLDKENVVFFEQGVLPCLTDDGKIFLDKPGVVAVAPDGNGGVYAALRNPVSPSSSA
PTILEDLRQRGVEFIHAYGVDNCLVRVADPVFLGYCISRNADCGAKVVKKTVPTESVGVV
ALKAGKFAVVEYSEISQEMAERKDASGSGDLAFRAANIANHFYSRQFLEEVSHFDEKQMP
YHIARKKIPHVDLASGETVKPSKPNGMKLEQFVFDVFPFTKSFALLEVERKSDFSPLKNA
PGTGSDDPETSRRDLLQEQKRWLEKAGAKVADGVEVELSPLVSYAGEGLEGVKGLEIKKS
GVVNSLDELKQLAT