Protein Info for mRNA_732 in Rhodosporidium toruloides IFO0880

Name: 9100
Annotation: HMMPfam-Dioxygenase-PF00775,HMMPfam-Catechol dioxygenase N terminus-PF04444,SUPERFAMILY--SSF49482

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04444: Dioxygenase_N
  • amino acids 88 to 157 (70 residues), 96.9 bits, E=5e-32
• PF00775: Dioxygenase_C
  • amino acids 167 to 332 (166 residues), 147.8 bits, E=2.5e-47

Best Hits

KEGG orthology group: None (inferred from 58% identity to cci:CC1G_09575)

Predicted SEED Role

"Catechol 1,2-dioxygenase 1 (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• catechol degradation to β-ketoadipate (1/4 steps found)
• superpathway of salicylate degradation (2/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (1/6 steps found)
• aromatic compounds degradation via β-ketoadipate (1/9 steps found)
• mandelate degradation to acetyl-CoA (1/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.1

Use Curated BLAST to search for 1.13.11.1

Protein Sequence (372 amino acids)

>mRNA_732 HMMPfam-Dioxygenase-PF00775,HMMPfam-Catechol dioxygenase N terminus-PF04444,SUPERFAMILY--SSF49482 (Rhodosporidium toruloides IFO0880)
MSSSSAKTRYGAGQGRPAKSSIRTMTATPAQPAPEQKKARHSLVGKAVAEAIKNGASNVD
LALLPRLRDLGPLNITENVLAINSLCPNPRQEFVFDKLVTHLHDFTREVSLTTEEWMLAI
EFLTATGKICSDIRQEFILLSDILGLSCLVDSMNHPSMPPATEGTVLGPFFTQDAADLKA
GESIASEGKGEYMWCEGRVLDTQGNPVPNCTIETWETDDEGLYDTQYEGRTVADCRGRLK
SDANGYYSYRAVLPTPYPIPNDRPVGRLLKTLNRHVFRPAHLHMMLVAEGYETLITALYF
KGDQFLESDAVFGVKSSLVVEPKLVTDETKAKALGFKHGPYWHLKKDYVLLTLEQADEQK
RKSLRNYYSSMK