Protein Info for mRNA_759 in Rhodosporidium toruloides IFO0880

Name: 9127
Annotation: K08486 STX1B_2_3 syntaxin 1B/2/3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 355 to 376 (22 residues), see Phobius details PF00804: Syntaxin" amino acids 119 to 315 (197 residues), 98.3 bits, see alignment E=7.3e-32 PF14523: Syntaxin_2" amino acids 128 to 233 (106 residues), 29.9 bits, see alignment E=9.1e-11 PF05739: SNARE" amino acids 322 to 369 (48 residues), 41.7 bits, see alignment 1.4e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>mRNA_759 K08486 STX1B_2_3 syntaxin 1B/2/3 (Rhodosporidium toruloides IFO0880)
MSRDRLREARNQQYGQGNAGGYGQPQQPAYGGPVGGGGGAGGYGGGPGYGQTQGSYGGGG
YGGYDSQPSAYNQAPAPSAYGAPNSYAPPVGQGDAYAMQPLNGGASRANGSLIGPDLGPF
FAEVESIQDDIKGLHSNINGVSELHSRRLASTDDATQSNTAAQLTQLTNQTTGLTNQIRQ
RILKLNEANRQSPQGDQGFNTRKLQIANLQNSFKRALEEYNMVEKRSREKYRDRMARQIK
IVKPDATDAEIKAAWEDSQGGAQIFSQALVSSRTQGARAAFAEVQSRNQDLRKIEETITQ
LAQMMQDMATLVLEQDESVKMIETQAVQVNTDVEHGLEQTKKAVKSARRARKMRWACFFI
ILAIIIVVVVVVVVEVLKNQGKL