Protein Info for mRNA_782 in Rhodosporidium toruloides IFO0880

Name: 9150
Annotation: K02917 RP-L35Ae, RPL35A large subunit ribosomal protein L35Ae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF01247: Ribosomal_L35Ae" amino acids 6 to 100 (95 residues), 147.7 bits, see alignment E=4.7e-48

Best Hits

Swiss-Prot: 64% identical to RL33B_YEAST: 60S ribosomal protein L33-B (RPL33B) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K02917, large subunit ribosomal protein L35Ae (inferred from 71% identity to lbc:LACBIDRAFT_179015)

Predicted SEED Role

"LSU ribosomal protein L35Ae" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>mRNA_782 K02917 RP-L35Ae, RPL35A large subunit ribosomal protein L35Ae (Rhodosporidium toruloides IFO0880)
MPSTRLYAKGRVTGFQRAKRNQRTNTSLVQVEGVADAKEAQWYLGKRVAYVYTAQKAIGG
SKVRIIWGKVTRPHGKSGMVRAKFRQNLPPKAFGHSVRIMLYPSNI