Protein Info for mRNA_800 in Rhodosporidium toruloides IFO0880

Name: 9168
Annotation: K10418 DYNLL dynein light chain LC8-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF01221: Dynein_light" amino acids 17 to 100 (84 residues), 124.6 bits, see alignment E=8.1e-41

Best Hits

Swiss-Prot: 60% identical to DYL1_DROME: Dynein light chain 1, cytoplasmic (ctp) from Drosophila melanogaster

KEGG orthology group: K10418, dynein light chain LC8-type (inferred from 62% identity to isc:IscW_ISCW003606)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>mRNA_800 K10418 DYNLL dynein light chain LC8-type (Rhodosporidium toruloides IFO0880)
MAADSQSDGTPAPEAPKPIIKSADMAQEMQDAAIKVATDAMQVADAEEKDIAAYIKREFD
RRYGPTWHVVVGKNYGSYCTHETGHFLYWYMGNIAILLFKAG