Protein Info for mRNA_804 in Rhodosporidium toruloides IFO0880

Name: 9172
Annotation: K17794 TIM23 mitochondrial import inner membrane translocase subunit TIM23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 253 to 269 (17 residues), see Phobius details PF02466: Tim17" amino acids 94 to 262 (169 residues), 80.8 bits, see alignment E=4.8e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>mRNA_804 K17794 TIM23 mitochondrial import inner membrane translocase subunit TIM23 (Rhodosporidium toruloides IFO0880)
MAAPVAHTPNSDDILGSHRFVQPGASTSSPYSAAAPTASSILSGATLDPAALHPLAGVVD
NKDLDYLLLEDDKLSAVAGGKTVLPSRGWGDELCYGTGSTYLAGLGLGGAWGFWEGLRRP
LAAPRATPSVAPASATAAATATAPTASAVGAQATAFAKEAAQQVTESAKQAAGAAGQAAQ
RVSARLRWNNILNQVTRRGTSMGNSAGVLALIYNGINSTIDVYRGHVHDVYGSMTAAALT
GLIWRSTAGIKPMVITSGLLTAGAAGWSWVKVQLL