Protein Info for mRNA_808 in Rhodosporidium toruloides IFO0880

Name: 9176
Annotation: K00053 ilvC ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR00465: ketol-acid reductoisomerase" amino acids 71 to 389 (319 residues), 373.4 bits, see alignment E=3.9e-116 PF07991: IlvN" amino acids 71 to 237 (167 residues), 160 bits, see alignment E=3.9e-51 PF01450: IlvC" amino acids 244 to 388 (145 residues), 139.1 bits, see alignment E=1.4e-44

Best Hits

Swiss-Prot: 74% identical to ILV5_YEAST: Ketol-acid reductoisomerase, mitochondrial (ILV5) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 76% identity to scm:SCHCODRAFT_82317)

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.86

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>mRNA_808 K00053 ilvC ketol-acid reductoisomerase (Rhodosporidium toruloides IFO0880)
MSARSAARALNIAVRQAAPKAARAYSLVAARRALPSAPKATRGVKTLDFAGTKETVYERA
DWPLPKLQEYFKNDTLALIGYGSQGHGQGLNARDNGLNVIVGVREGGESWKQAQEDGWVP
GKNLFPIDEAIKKGSIIMNLLSDAAQSQTWKDIKPLITEGKTLYFSHGFSLVYSKDTGVE
APSNVDVILCAPKGSGRTVRTLFKEGRGINASIAVWQDVTGKAMEKARALAVAVGTGYAY
ETTFEKEVYSDLYGERGVLMGGIQGMFLAQYKVLRENGHSPSEAFNETVEEATQSLFPLI
GQYGMDYMYNACSTTARRGALDWAPIFEAANKPVFEKLYKSVRDGTETRRSLQFNSQPNY
REAFAKETAEIDNQEIWRAGKTVRSLRPDAKNN