Protein Info for mRNA_832 in Rhodosporidium toruloides IFO0880

Name: 9200
Annotation: K08835 OXSR1, STK39 serine/threonine-protein kinase OSR1/STK39

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07714: Pkinase_Tyr" amino acids 186 to 461 (276 residues), 132.4 bits, see alignment E=2.8e-42 PF00069: Pkinase" amino acids 210 to 465 (256 residues), 172.5 bits, see alignment E=1.8e-54

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>mRNA_832 K08835 OXSR1, STK39 serine/threonine-protein kinase OSR1/STK39 (Rhodosporidium toruloides IFO0880)
MLTFCVLVVVFTPGIASLVLASSLSPTPHHLRLLPPVHARLYEPPTFARRPAMAVASASS
SSSSKPKKGSSWLSSAKAGLKSIGGHTSAPMSTTSSSSSTLIEGPGNGASGAANGAGSTG
KLARVVSRTSKGKERAVEPDNPRLEAMVGSVAASLADMPAIAPRKIIGAVEDEWPLYSCR
PSDYEIGEPVGYGAAAVVHMATFCPANVTPRPKPLTCAVKIIDVDRMATDADIQRLRMET
QLMALSKHPNVLRVRGQWVAGSKLHIAVRYMAHGSLLDISRYAFPDGFPEDVIACVLAQA
LNGLLYLHQNGWIHRDIKAANLLVDDDGTVLLADFGVSSSLFPDTTSGTRGEAIIRDAMA
PRKSFVGTPCWMAPEVVERKAYDSKADIWSFGITALELASGRAPNSLYPPAKALSKTIMD
DPPELDREGGKYKYSKEMGKMIESCLQKDPAKRPTAEKLLQHPFFRGAKKKGFLVSALLD
DLPPLQDRQHRRRRASASNGDTFASWDFNPTVLHTPQRTTSSDDPFDGFSAAPSPLHPRR
SFSFQQQPDLRGSLRLGPTSRDRDTSKASSHRRGISFDLDPSPATSPRTTAGFSLTGSVH
FEEPEAVTEKDDEKSEEEKAT