Protein Info for mRNA_844 in Rhodosporidium toruloides IFO0880

Name: 9212
Annotation: KOG1111 N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 129 to 150 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 620 to 641 (22 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 57 to 222 (166 residues), 74.1 bits, see alignment E=2.8e-24 PF13579: Glyco_trans_4_4" amino acids 58 to 215 (158 residues), 44 bits, see alignment E=7e-15 PF00534: Glycos_transf_1" amino acids 288 to 418 (131 residues), 99.2 bits, see alignment E=4.1e-32 PF13692: Glyco_trans_1_4" amino acids 292 to 418 (127 residues), 75.8 bits, see alignment E=9.1e-25

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>mRNA_844 KOG1111 N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase (Rhodosporidium toruloides IFO0880)
MSAATLPALPKPLSGRELDLLEKANSSTPTGASNGQTTERRALRIAIVTENFLPKIDGVT
RTLAMLLEHLQAEGHEALVLGPASTLTSYAGAEVVSTKGIPLLGVYRGLGLNFLRPRFIR
KLREFKPDIIQFTDPIWLCAQTIPMVQYYFPDTPLVSSYHTNLAMYATLFGFSWLTPVMW
SLQRNLHGRCHLSFCPSPSTARMLEQQGFQNLRIWPRGVDVEMFRPEARDYALRQRWGVE
PQDLDADRPSPRVHASDNRIPCEELPPLNLPPPYSAQPAASTFSATSPSKLVVLYVGRIS
WEKNLRLLIEAYRGLEEPDLATNRPACQLIFVGDGPARAEAESLCKKYGLDALFLGFKKG
EQLAAAYASADIFAFPSFTETFGQVVSEAQASGLPVVGLKAEGVSDLVDHGRTGLLLDLN
ALRPAPSSGSQPPAYSATPSAIPSDPHALLDLSSPTFPAAVALYRSLIASLATDPEQRRT
MAATAHDVASKRSWFGAMEQLVDGYRDLTAARDARLAQREKDELSLSRTSTIEFDVVCDA
GAEKVDGETAQSTGASTPQRRRRLLRLDGVFKRSGRRFQDGSVSLTPLKWLAPKPAMVAT
NGGIVLTASKGEDGASSKLMVHLLEGAVFFCLLYVAVSWMAQLEAISFIHV