Protein Info for mRNA_852 in Rhodosporidium toruloides IFO0880

Name: 9220
Annotation: K01923 purC phosphoribosylaminoimidazole-succinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01259: SAICAR_synt
  • amino acids 15 to 275 (261 residues), 296 bits, E=1.4e-92
• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 15 to 317 (303 residues), 213.5 bits, E=2.1e-67

Best Hits

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 51% identity to ppl:POSPLDRAFT_89397)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis I (4/6 steps found)
• inosine-5'-phosphate biosynthesis III (3/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Protein Sequence (320 amino acids)

>mRNA_852 K01923 purC phosphoribosylaminoimidazole-succinocarboxamide synthase (Rhodosporidium toruloides IFO0880)
MTALLQTDCPTLKLLARGKVRDIYEVEEDKSGLLFVATDRVSAFDVIMKTGIPNKGKLLT
QLSLFFFDYLSKAPETKHIPNHVITSKIEEMPTQVQKYRDQLEGRSIWVRRATVLPVEAI
VRGYITGSAWAEYQKTGTMHDIQLPEGLKESSKFDPPLFTPSTKAEVGDKDINIHPNELP
KHLPDPALAEPLQQYALALYSTAAAHSLSRGLILADTKFEFGLLPPSTPDGKPVLALVDE
CLTPDSSRFWPAEQWAEGNKMVGFDKQFLREWLKSGGGGFGKKGGGIEEDPVEIPQDIVQ
ATWSKYEEAFEKLTGRKFVA